Anti-SHMT2/SHMT Rabbit Polyclonal Antibody
ANTIA308252-100
New Product
- Antibody type:Primary
- Antigen symbol:SHMT2/SHMT
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- ImmunoPrecipitation:Yes
- Isotype:IgG
- Reactivity:Human
- Environmentally Preferable:
- Form:Liquid
- Gene ID:UniprotID# P34897
- Storage buffer:Supplied in phosphate buffered saline, pH 7,3, with 50% glycerol and 0,01% thiomersal
- Sequence:PSPFKHADIVTTTTHKTLRGARSGLIFYRKGVKAVDPKTGREIPYTFEDRINFAVFPSLQGGPHNHAIAAVAVALKQACTPMFREYSLQVLKNARAMADALLERGYSLVSGGTDNHLVLVDLRPKGLDGARAERVLELVSITANKNTCPGDRSAITPGGLRLGAPALTSRQFREDDFRRVVDFIDEGVNIGLEVKSKTAKLQDFKSFLLKDSETSQRLANLRQRVEQFARAFPMPGFDEH
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 265-504 of human SHMT2 (NP_005403.2)
- Tested applications:IHC, ICC/IF
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Rabbit polyclonal antibody to SHMT2/SHMT for IHC, ICC/IF and IP with samples derived from human.
- Validated applications: IHC, ICC/IF, IP
- Recommended dilutions: IHC: 1:50 to 1:100, ICC/IF1:50 to 1:200:, IP: 1:500 to 1:1,000
Type: Primary
Antigen: SHMT2/SHMT
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human